PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06570g01007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 284aa    MW: 30580.7 Da    PI: 9.9985
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06570g01007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.94e-373591561
                    zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                               +kcprCds+ntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGggrrk k +
  Niben101Scf06570g01007.1 35 PQKCPRCDSNNTKFCYYNNYSLTQPRYFCKTCRRYWTQGGTLRNVPVGGGRRKGKCT 91
                              689**************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-20581IPR003851Zinc finger, Dof-type
PfamPF027011.1E-313689IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.233690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEQGRSGGES DRYQQRKMKM PDDLSAAAQP PQPPPQKCPR CDSNNTKFCY YNNYSLTQPR  60
YFCKTCRRYW TQGGTLRNVP VGGGRRKGKC TTRGGGGSSS SSAGESSSRS SHVAQLPPVV  120
PLHNMTTNLS ATAAFFSGNS ISRSQPLNSV YSSGGFLSSL AAMQSQGVNQ PSNSQFGGTS  180
NTVLLQGFHN LPKEPQQTGL YQMVNREKSN ESSFYLSDQT LQFQPTRPLG SWTQRFINNN  240
NNMASWNCPA GSSSGIGGAT NSTTAGSSLS PNQWPDMPGF GPSP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775304.11e-157PREDICTED: dof zinc finger protein DOF5.8-like
RefseqXP_016492349.11e-157PREDICTED: dof zinc finger protein DOF5.8-like
TrEMBLM1CWN84e-74M1CWN8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000763971e-73(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-26TARGET OF MONOPTEROS 6